PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG090800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 877aa    MW: 93901 Da    PI: 5.7533
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG090800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-20137192156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Pavir.7KG090800.1.p 137 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 192
                          688999***********************************************998 PP

2START126.63e-403565932206
                          HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS....................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT CS
                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...................dsgealrasgvvdmvlallveellddkeqW 72 
                          la +aa+ l k+  a+ep+Wv+ +    + ev+   e ++                     ++e +r+s+vv+ ++ +lv  +ld + +W
  Pavir.7KG090800.1.p 356 LAATAADTLAKMCRAGEPLWVRCR--GASSEVMVADEHARMfswpvdggkqgggsaaaaaARTEGSRDSAVVIINSITLVDAFLDAN-KW 442
                          57889999****************..44444444444444457788888899*******99**************************.** PP

                          -TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTSEE-EE CS
                START  73 detla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssvvRael 147
                           e ++    ka t++vi+ g        gal+lm+ae q++splv  R++vf Ry+    ++g+w +vd   +  q     +ssvv++++
  Pavir.7KG090800.1.p 443 MELFPsivsKARTIQVINHGaasghlgsGALVLMQAEVQFPSPLVTaREVVFFRYCVHnPEEGTWSVVDFPAEGFQLEALqTSSVVKCRR 532
                          **********************************************************9999*******888888877779********* PP

                          SSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 148 lpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                          +pSg++i++++ng+s+v+wveh+++ g     h++++  v +g+a+ga +wv+ lqrqce+
  Pavir.7KG090800.1.p 533 RPSGCIIQDMPNGYSRVVWVEHMEMVGEEKplHQVFKDYVTNGTAFGATRWVSLLQRQCER 593
                          ************************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-21124188IPR009057Homeodomain-like
SuperFamilySSF466891.55E-19128195IPR009057Homeodomain-like
PROSITE profilePS5007117.086134194IPR001356Homeobox domain
SMARTSM003891.1E-19135198IPR001356Homeobox domain
PfamPF000463.7E-18137192IPR001356Homeobox domain
CDDcd000866.91E-19137195No hitNo description
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
PROSITE profilePS5084844.059346596IPR002913START domain
SuperFamilySSF559612.75E-29349595No hitNo description
PfamPF018522.3E-32356593IPR002913START domain
CDDcd088752.27E-91366592No hitNo description
SMARTSM002343.5E-17377593IPR002913START domain
Gene3DG3DSA:3.30.530.206.7E-4476559IPR023393START-like domain
SuperFamilySSF559616.59E-16611854No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 877 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFIPNPG ALAGFMSSSA AAMPFHHFST TTTSLIPKEE  60
GGGIMGALVQ AAKDEDMELE MDMELSGGSG SGRLDGLLSF ADVDDDRSEQ KPQHGGLELQ  120
TADAAGNQQL ATNSGKKKRY HRHTAHQIQQ MEALFKECPH PDDKQRLKLS QELGLKPRQV  180
KFWFQNRRTQ MKAQQDRADN VLLRAENESL KSDNYRLQAA IRNVVCPNCG HAAVLAEMSY  240
EEQQLRIENA RLKDELDRLA CMATRYGGGR QPSMASALGC LPAPPPLLMP PLDLDMSVYS  300
RHFTDQSSVM GCGDLIQSVL APPQQITAGA EHHDASSYMG SMAPVPEQDR QVVLDLAATA  360
ADTLAKMCRA GEPLWVRCRG ASSEVMVADE HARMFSWPVD GGKQGGGSAA AAAARTEGSR  420
DSAVVIINSI TLVDAFLDAN KWMELFPSIV SKARTIQVIN HGAASGHLGS GALVLMQAEV  480
QFPSPLVTAR EVVFFRYCVH NPEEGTWSVV DFPAEGFQLE ALQTSSVVKC RRRPSGCIIQ  540
DMPNGYSRVV WVEHMEMVGE EKPLHQVFKD YVTNGTAFGA TRWVSLLQRQ CERLASELAR  600
NIADLGVIRS PEARTNMMKL SQRMITTFCS NISASGSQSW TTLSESTEDT IRVTTRKNTD  660
SGQPSGVILT AVSTSWLPFS HQQVFELLAD EQQRCQLEIL SNGGSLHEVA HIANGSHPRN  720
CISLLRINAA SNSSQNVELL LQESSTHPNG GSLVVFATVD VEAIQVTMSG EDPSYIPLLP  780
LGFAIFPATN PSPAATSASS GNGGESSPGN PDEPASGCLL TVGMQVLASA VPSAKLNLSS  840
ITAINSHVCN AIHQITTALK GAGASRAEPA SVGGSN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400406GGKQGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76670.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509860.0AJ250986.2 Zea mays mRNA for OCL4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983556.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_004983555.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLK4A5P80.0K4A5P8_SETIT; Uncharacterized protein
STRINGSi034202m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7